.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an exopolyphosphatase-related protein from Bacteroides fragilis. NorthEast Structural Genomics target BfR192. To be Published
    Site NESGC
    PDB Id 3dma Target Id BfR192
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS8756,3.90.1640.10, PF01368, PF02272 Molecular Weight 39157.88 Da.
    Residues 343 Isoelectric Point 5.60
    Sequence mltkviaqahidhftkwferadkivivshvspdgdaigsslglyhfldsqdkivnvivpnafpdflkwm pgskdillydryqefadklimeadviccldfnalkridemsdivaaspgrkimidhhlypedfcritis hpeisstselvfrlicrmgyfsdiskegaeciytgmmtdtggftynsnnreiyfiisellskgidkddi yrkvyntysesrlrlmgyvlsnmkvykdynsalisltkeeqgkfdyikgdsegfvniplsiknvcfscf lredtekkmikislrsvgkfpcnrlaaeffnggghlnasggefygtmeeavkvfeqalekykpllke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.259
    Matthews' coefficent 3.23 Rfactor 0.223
    Waters 164 Solvent Content 61.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dma
    1. Towards more accurate pharmacophore modeling: Multicomplex-based comprehensive pharmacophore map and most-frequent-feature pharmacophore model of
    J Zou, HZ Xie, SY Yang, JJ Chen, JX Ren - Journal of Molecular , 2008 - Elsevier
     
    2. 2', 3'-cAMP hydrolysis by metal-dependent phosphodiesterases containing DHH, EAL, and HD domains is non-specific: Implications for PDE screening
    F Rao, Y Qi, E Murugan, S Pasunooti, Q Ji - Biochemical and biophysical , 2010 - Elsevier
     
    3. Structural and Functional Assays of AtTLP18. 3 Identify Its Novel Acid Phosphatase Activity in Thylakoid Lumen
    HY Wu, MS Liu, TP Lin, YS Cheng - Plant physiology, 2011 - Am Soc Plant Biol
     
    4. Role of RecJ-like protein with 5_-3_ exonuclease activity in oligo (deoxy) nucleotide degradation
    T Wakamatsu, K Kim, Y Uemura, N Nakagawa - Journal of Biological , 2011 - ASBMB
     
    5. Development of resistance against blackleg disease in Brassica oleracea var. botrytis through in silico methods
    M Srivastava, BA Akhoon, SK Gupta - Fungal Genetics and , 2010 - Elsevier
     
    6. Kinetoplastid RNA editing ligases 1 and 2 exhibit different electrostatic properties
    A Shaneh, R Salavati - Journal of Molecular Modeling, 2010 - Springer
     
    7. Multicomplex_Based Pharmacophore Guided 3d_Qsar Studies of N_Substituted 2'_(Aminoaryl) Benzothiazoles as Aurora_a Inhibitors
    G He, M Qiu, R Li, L Ouyang, F Wu - Chemical Biology & , 2012 - Wiley Online Library
     
    8. Integrated structure-based activity prediction model of benzothiadiazines on various genotypes of HCV NS5b polymerase (1a, 1b and 4) and its application in the
    MAH Ismail, DA Abou El Ella, KAM Abouzid - Bioorganic & Medicinal , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch