.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dme

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141. To be Published
    Site NESGC
    PDB Id 3dme Target Id BeR141
    Molecular Characteristics
    Source Bordetella pertussis
    Alias Ids TPS31758,PF00890, 3.50.50.60, 3.40.50.720, 3.30.9.10, PF01266 Molecular Weight 38416.31 Da.
    Residues 369 Isoelectric Point 5.69
    Sequence mstdidcivigagvvglaiaralaagghevlvaeaaegigtgtssrnsevihagiyypadslkarlcvr gkhllyeycaargvphqrlgklivatsdaeasqldsiarragangvddlqhidgaaarrlepalhctaa lvspstgivdshalmlayqgdaesdgaqlvfhtpliagrvrpeggfeldfggaepmtlscrvlinaagl hapglarriegiprdsippeylckgsyftlagrapfsrliypvpqhaglgvhltldlggqakfgpdtew iatedytldprradvfyaavrsywpalpdgalapgytgirpkisgphepaadfaiagpashgvaglvnl ygiespgltaslaiaeetlarlaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.21722
    Matthews' coefficent 2.36 Rfactor 0.18889
    Waters 648 Solvent Content 47.92

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2;TLA (L(+)-TARTARIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 3dme
    1. Comparison of structure_based and threading_based approaches to protein functional annotation
    M Brylinski, J Skolnick - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. Detection and annotation of ligand binding sites based on atomic descriptors
    JC Nebel - 2009 - Citeseer
     
    3. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch