.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dsm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the surface layer protein BACUNI_02894 from Bacteroides uniformis, Northeast Structural Genomics Consortium Target BtR193D. To be Published
    Site NESGC
    PDB Id 3dsm Target Id BtR193D
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8776,2.140.10.20, 2.130.10.10, 2.120.10.30 Molecular Weight 37038.87 Da.
    Residues 320 Isoelectric Point 4.63
    Sequence asglfitnegnfqysnatlsyydpatcevenevfyrangfklgdvaqsmvirdgigwivvnnshvifai dintfkevgritgftspryihflsdekayvtqiwdyrifiinpktyeitgyiecpdmdmesgsteqmvq ygkyvyvncwsyqnrilkidtetdkvvdeltigiqptslvmdkynkmwtitdggyegspygyeapslyr idaetftvekqfkfklgdwpsevqlngtrdtlywinndiwrmpveadrvpvrpflefrdtkyygltvnp nngevyvadaidyqqqgivyryspqgklidefyvgiipgafcwk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.202
    Matthews' coefficent 2.09 Rfactor 0.168
    Waters 384 Solvent Content 41.27

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3dsm
    1. The other 90% of the protein: Assessment beyond the C_s for CASP8 template_based and high_accuracy models
    DA Keedy, CJ Williams, JJ Headd - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. The biomolecular interaction network database in PSI-MI 2.5
    R Isserlin, RA El-Badrawi, GD Bader - Database: The Journal of , 2011 - ncbi.nlm.nih.gov
     
    3. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     
    4. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    5. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch