.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dto

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the metal-dependent HD domain-containing hydrolase BH2835 from Bacillus halodurans, Northeast Structural Genomics Consortium Target BhR130. To be Published
    Site NESGC
    PDB Id 3dto Target Id BhR130
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8759,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 24630.78 Da.
    Residues 215 Isoelectric Point 5.17
    Sequence mneqailqsaeawvkkqlmdeysghdwyhirrvtlmakaigeqekvdvfvvqiaalfhdliddklvddp etakqqlidwmeaagvpsqkidhtmdiintisfkgghgqslatreamvvqdadrldalgaigiartfay sgnkgqpiydpelpiretmtveeyrhgkstainhfyeklfklkdlmntetgkqlakerhvfmeqfierf lsewngdm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.30 Rfree 0.292
    Matthews' coefficent 2.48 Rfactor 0.248
    Waters Solvent Content 50.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch