.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e23

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the RPA2492 protein in complex with SAM from Rhodopseudomonas palustris, Northeast Structural Genomics Consortium Target RpR299. To be Published
    Site NESGC
    PDB Id 3e23 Target Id RpR299
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS20392,3.40.50.150, PF01135, PF08242, PF08241 Molecular Weight 22469.96 Da.
    Residues 203 Isoelectric Point 5.11
    Sequence mepdmtqafdddtlrfyrgnatayaerqprsatltkflgelpagakilelgcgagyqaeamlaagfdvd atdgspelaaeasrrlgrpvrtmlfhqldaidaydavwahacllhvprdeladvlkliwralkpgglfy asyksgegegrdklaryynypseewlraryaeagtwasvavessegkgfdqelaqflhvsvrkpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.183
    Matthews' coefficent 2.45 Rfactor 0.16
    Waters 317 Solvent Content 49.85

    Ligand Information
    Ligands SO4 (SULFATE) x 5;SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch