.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e5z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the putative gluconolactonase in protein family PF08450. Northeast Structural Genomics Consortium target DrR130. To be Published
    Site NESGC
    PDB Id 3e5z Target Id DrR130
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS20380,2.130.10.10, 2.120.10.30, PF08450 Molecular Weight 31574.43 Da.
    Residues 288 Isoelectric Point 5.20
    Sequence mtlraarpefldlfpagaearrladgftwtegpvyvparsavifsdvrqnrtwawsddgqlspemhpsh hqnghclnkqghliacshglrrlerqrepggewesiadsfegkklnspndvclapdgslwfsdptygid kpeegyggemelpgrwvfrlapdgtlsapirdrvkpnglaflpsgnllvsdtgdnathryclnargete yqgvhftvepgktdglrvdaggliwasagdgvhvltpdgdelgrvltpqttsnlcfggpegrtlymtvs tefwsietnvrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.22908
    Matthews' coefficent 2.40 Rfactor 0.19282
    Waters 239 Solvent Content 48.78

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3e5z
    1. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch