The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein Q8E9M7 from Shewanella oneidensis related to thioesterase superfamily. Northeast Structural Genomics Consortium target SoR246. To be Published
    Site NESGC
    PDB Id 3e8p Target Id SoR246
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS20396,PF03061, Molecular Weight 16907.52 Da.
    Residues 154 Isoelectric Point 5.81
    Sequence msnpiqaevlkrvaevfdqhvpfhnllgldikrydidgvevainmkpelignihqqilhggvtatvldv vggltafaglvasrddwtieelqqrlqtlgtidmrvdylrpgrgqiftgtgsviragnrvsvcrmelhn eqgthiafgtgtymvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.242
    Matthews' coefficent 2.12 Rfactor 0.207
    Waters 81 Solvent Content 41.93

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch