.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eli

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the AHSA1 (SPO3351) protein from Silicibacter pomeroyi, Northeast Structural Genomics Consortium Target SiR160. To be Published
    Site NESGC
    PDB Id 3eli Target Id SiR160
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS21080,PF08327, 3.30.530.20 Molecular Weight 16303.50 Da.
    Residues 144 Isoelectric Point 5.15
    Sequence madlrlerefavapealfawvsdgakllqwwgpeglhvpadqhdldftrlgpwfsvmvngegqrykvsg qvthvkppqsvgftwgwhddddrrgaeshvmfivepcakgarlildhrelgddemslrheegwtsslrk laaela
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.265
    Matthews' coefficent 3.51 Rfactor 0.217
    Waters 10 Solvent Content 65.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3eli
    1. Integrative Structure Determination of the Components of the Nuclear Pore Complex by X-ray Crystallography, Small Angle X-Ray Scattering, Electron
    D Schneidman, T Matsui, H Tsuruta, M Sauder - PDB40, 2011 - meetings.cshl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch