.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eqe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YubC protein from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 3eqe Target Id SR112
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS24582,PF07883, 2.60.120.10, PF05995 Molecular Weight 18125.62 Da.
    Residues 161 Isoelectric Point 5.21
    Sequence melyeciqdifgglknpsvkdlatslkqipnaaklsqpyikepdqyaygrnaiyrnneleiivinippn kettvhdhgqsigcamvlegkllnsiyrstgehaelsnsyfvhegeclistkglihkmsnptsermvsl hvysppledmtvfeeqkevlens
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.82 Rfree 0.296
    Matthews' coefficent 2.72 Rfactor 0.241
    Waters 64 Solvent Content 54.70

    Ligand Information
    Ligands
    Metals FE (FE) x 2

    Jmol

     
    Google Scholar output for 3eqe
    1. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch