.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ew7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Lmo0794 protein from Listeria monocytogenes. To be Published
    Site NESGC
    PDB Id 3ew7 Target Id LmR162
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS24566,3.40.50.720, PF01113, PF05368 Molecular Weight 23354.88 Da.
    Residues 213 Isoelectric Point 5.23
    Sequence mkigiigatgragsrileeaknrghevtaivrnagkitqthkdinilqkdifdltlsdlsdqnvvvday gvspdeaekhvtsldhlisvlngtvsprllvvggaaslqidedgntlleskglreapyyptaraqakql ehlrshqaefswtyispsamfepgertgdyqigkdhllfgsdgnsfismedyaiavldeierpnhlner ftvagk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.73 Rfree 0.247
    Matthews' coefficent 3.80 Rfactor 0.224
    Waters 77 Solvent Content 67.65

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch