.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f08

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative uncharacterized protein Q6HG14 from Bacilllus thuringiensis. Northeast Structural Genomics Consortium target BuR153. To be Published
    Site NESGC
    PDB Id 3f08 Target Id BuR153
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS27211,3.30.530.20, PF10604 Molecular Weight 15546.55 Da.
    Residues 138 Isoelectric Point 4.60
    Sequence mahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiierlevfnekery ytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeainlfhgiysdglkalqhafld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.237
    Matthews' coefficent 2.75 Rfactor 0.203
    Waters 123 Solvent Content 55.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch