The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three dimensional structure of the serine acetyltransferase from Bacteroides vulgatus, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET BVR62. To be Published
    Site NESGC
    PDB Id 3f1x Target Id BvR62
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS27215,1.10.3130.10, Molecular Weight 32795.47 Da.
    Residues 302 Isoelectric Point 5.99
    Sequence mttfnytniltqavdelsesqsykglfhqhkdgdplpsakslykivelaraiifpgyfgnstvnshtin yhigvnvetlfgllteqilaglcfgqensknatddnepcretasllaarfisklpelrrilatdveaay ygdpaatcfgeiiscypairaisnyriahellilgvpliprfitemahsetgidihpgaqighhftidh gtgvvigatsiignnvklyqgvtlgaksfpldnngnpikgiprhpileddvivysnatilgrvtigkga tvggniwvtenvpagsrivqrknkde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.258
    Matthews' coefficent 2.19 Rfactor 0.214
    Waters 153 Solvent Content 43.73

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch