.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f3b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the phage-like element PBSX protein xkdH from Bacillus Subtilus. Northeast Structural Genomics Consortium target SR352. To be Published
    Site NESGC
    PDB Id 3f3b Target Id SR352
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27289,PF12206 Molecular Weight 13978.17 Da.
    Residues 118 Isoelectric Point 6.03
    Sequence msyrqmlihrcdiyheaaqapsagrfgipadrlqpvisypdtpdeqdvpcyftektqqliqeepdqtvy hsflvhfplsadirvndkiiwenhkyilklpkrirhhhwevvavrdesl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.263
    Matthews' coefficent 2.46 Rfactor 0.230
    Waters 60 Solvent Content 49.93

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3f3b
    1. The crystal structure of bacteriophage HK97 gp6: defining a large family of head-tail connector proteins
    L Cardarelli, R Lam, A Tuite, LA Baker - Journal of molecular , 2010 - Elsevier
     
    2. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    3. Genome gating in tailed bacteriophage capsids
    P Tavares, S Zinn-Justin, EV Orlova - Viral Molecular Machines, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch