.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f4k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable methyltransferase from Bacteroides thetaiotaomicron. Northeast Structural Genomics target BtR309. To be Published
    Site NESGC
    PDB Id 3f4k Target Id BtR309
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS27205,3.40.50.150, PF08241, PF01209 Molecular Weight 29457.61 Da.
    Residues 257 Isoelectric Point 4.85
    Sequence msnnntsihdfdfsficnyfkllkrqgpgspeatrkavsfineltddakiadigcgtggqtlfladyvk gqitgidlfpdfieifnenavkancadrvkgitgsmdnlpfqneeldliwsegaiynigfergmnewsk ylkkggfiavseaswftserpaeiedfwmdaypeisviptcidkmeragytptahfilpencwtehyfa pqdevretfmkehagnktamdfmkgqqyerslyskykdyygyvfyigqkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.244
    Matthews' coefficent 2.59 Rfactor 0.211
    Waters 75 Solvent Content 52.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f4k
    1. Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
    V Kumar, J Sivaraman - Journal of structural biology, 2011 - Elsevier
     
    2. Purification, crystallization and diffraction studies of the methyltransferases BT_2972 and BVU_3255 from antibiotic-resistant pathogens of the genus Bacteroides from
    V Kumar, N Mallika, J Sivaraman - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     
    3. A Conformational Switch in the Active Site of BT_2972, a Methyltransferase from an Antibiotic Resistant Pathogen B. thetaiotaomicron
    V Kumar, J Sivaraman - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch