.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fac

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 3fac Target Id RhR83
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS27287,3.90.1590.10, BIG_233, PF04828 Molecular Weight 13248.25 Da.
    Residues 118 Isoelectric Point 8.22
    Sequence mkgtchcgaveievellngfadarrcdcsfcrrrgaiaatarlsdlrvvrgaenltlyqfgtrtakhwf crtcgiythhqrrsnpeeygvnvailegvnprdlgevpwtdgvnhpsdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.50 Rfree 0.258
    Matthews' coefficent 2.76 Rfactor 0.225
    Waters 328 Solvent Content 55.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fac
    1. Young Scientist Forum
    A Amunts - FEBS Journal, 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch