.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fb2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the human brain alpha spectrin repeats 15 and 16. To be Published
    Site NESGC
    PDB Id 3fb2 Target Id HR5563A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27251,1.20.58.60, PF00435 Molecular Weight 24103.76 Da.
    Residues 208 Isoelectric Point 5.22
    Sequence dshdlqrflsdfrdlmswingirglvssdelakdvtgaeallerhqehrteidaragtfqafeqfgqql lahghyaspeikqkldildqeradlekawvqrrmmldqclelqlfhrdceqaenwmaareaflntedkg dsldsvealikkhedfdkainvqeekiaalqafadqliaaghyakgdissrrnevldrwrrlkaqmiekr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.248
    Matthews' coefficent 3.42 Rfactor 0.219
    Waters 280 Solvent Content 64.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fb2
    1. Biochemical studies and crystal structure determination of dihydrodipicolinate synthase from Pseudomonas aeruginosa
    N Kaur, A Gautam, S Kumar, A Singh, N Singh - International Journal of , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch