.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fer

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of n-terminal actin-binding domain from human filamin b (tandem ch-domains). northeast structural genomics consortium target hr5571a. To be Published
    Site NESGC
    PDB Id 3fer Target Id HR5571A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27253,PF00307, 1.10.418.10 Molecular Weight 28931.84 Da.
    Residues 252 Isoelectric Point 5.99
    Sequence mpvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsqkrmyrkyhqr ptfrqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlilhysismpvwedegdddakk qtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvdnareamqqadd wlgvpqvitpeeiihpdvdehsvmtylsqfpkaklkpgaplkpkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.259
    Matthews' coefficent 2.60 Rfactor 0.215
    Waters 153 Solvent Content 52.68

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3fer
    1. Structure of the human filamin A actin-binding domain
    S Ruskamo, J Ylanne - Acta Crystallographica Section D: Biological , 2009 - scripts.iucr.org
     
    2. Isoform divergence of the filamin family of proteins
    BA Kesner, SL Milgram, BRS Temple - Molecular biology and , 2010 - SMBE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch