.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fgb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q89ZH8_BACTN protein from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 3fgb Target Id BtR289B
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS27203,PF10282, 2.140.10.20, 2.130.10.10, 2.140.10.30, 2.120.10.30, 2.120.10.60 Molecular Weight 38203.64 Da.
    Residues 352 Isoelectric Point 5.06
    Sequence aeqdltmivgtytsgdskglysfrfneengtatalseaevenpsylvpsadgkfiyavsefsneqaaan afafnkeegtfrllntqktggedpcyiitngsnvvtanysggsisvfpidkdgsllpasevvkfkgsga dkerqekphlhcvritpdgkylfaddlgtdqihkfivnpnakadnedvflkegspasykveagsgprhl tfapngsyaylinelsgtviafeyndgelkeiqtiaadtvgakgsgdihispdgkflyasnrlkadgla ifsihpengmltkvgyqltgihprnfiitpngkyllvacrdsnviqvyerdtdtglltdirkdikvdkp vcikfvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.240
    Matthews' coefficent 2.12 Rfactor 0.225
    Waters 663 Solvent Content 42.06

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch