.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fhw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein priB from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR162. To be Published
    Site NESGC
    PDB Id 3fhw Target Id BpR162
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS31754,2.40.50.140 Molecular Weight 11423.73 Da.
    Residues 107 Isoelectric Point 6.40
    Sequence mntlelsarvlecgamrhtpaglpalelllvhesevveaghprrveltisavalgdlallladtplgte mqvqgflaparkdsvkvklhlqqarriagsmgrdplvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.28875
    Matthews' coefficent 2.66 Rfactor 0.27544
    Waters 121 Solvent Content 53.76

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals NA (SODIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch