The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the EH 1 domain from human intersectin-1 protein. To be Published
    Site NESGC
    PDB Id 3fia Target Id HR3646E
    Related PDB Ids 2khn 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27244,16250, Molecular Weight 12372.68 Da.
    Residues 111 Isoelectric Point 6.71
    Sequence maqfptpfggsldiwaitveerakhdqqfhslkpisgfitgdqarnfffqsglpqpvlaqiwaladmnn dgrmdqvefsiamkliklklqgyqlpsalppvmkqqpvaiss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.17643
    Matthews' coefficent Rfactor 0.15963
    Waters 133 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CA (CALCIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch