.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fif

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A. To be Published
    Site NESGC
    PDB Id 3fif Target Id ER382A
    Related PDB Ids 2jn0 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8845,15079, 2.30.30.100, PF06004 Molecular Weight 5974.27 Da.
    Residues 53 Isoelectric Point 4.23
    Sequence mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiier
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.25253
    Matthews' coefficent 1.96 Rfactor 0.23802
    Waters 91 Solvent Content 37.13

    Ligand Information
    Ligands GLY-GLY-GLY-GLY-GLY-GLY-GLY x 1
    Metals

    Jmol

     
    Google Scholar output for 3fif
    1. Improved Technologies Now Routinely Provide Protein NMR Structures Useful for Molecular Replacement
    B Mao, R Guan, GT Montelione - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch