.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fmv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the serine phosphatase of RNA polymerase II CTD (SSU72 superfamily) from Drosophila melanogaster. Monoclinic crystal form. Northeast Structural Genomics Consortium target FR253. To be Published
    Site NESGC
    PDB Id 3fmv Target Id FR253
    Related PDB Ids 3fdf 
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS27234,3.40.50.270, PF04722 Molecular Weight 22731.81 Da.
    Residues 195 Isoelectric Point 5.10
    Sequence mtdpsklavavvcssnmnrsmeahnflakkgfnvrsygtgervklpgmafdkpnvyefgtkyediyrdl eskdkefytqngllhmldrnrrikkcperfqdtkeqfdiivtveervydlvvmhmesmesvdnrpvhvl nvdvvdnaedalmgafvitdminmmakstdldndideliqefeerrkrvilhsvlfy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 3.31 Rfree 0.280
    Matthews' coefficent 2.60 Rfactor 0.228
    Waters Solvent Content 52.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fmv
    1. Crystal structure of Ssu72, an essential eukaryotic phosphatase specific for the C-terminal domain of RNA polymerase II, in complex with a transition state analogue
    Y Zhang, M Zhang - Biochem. J, 2011 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch