.
The Open Protein Structure Annotation Network
PDB Keyword
.

3foj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of SSP1007 From Staphylococcus saprophyticus subsp. saprophyticus. Northeast Structural Genomics Target SyR101A. To be Published
    Site NESGC
    PDB Id 3foj Target Id SyR101A
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS27308,3.40.250.10, PF00581 Molecular Weight 10599.22 Da.
    Residues 97 Isoelectric Point 3.92
    Sequence mesitvtelkekildanpvnivdvrtdqetamgiipgaetipmnsipdnlnyfndnetyyiickaggrs aqvvqyleqngvnavnveggmdefgdeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.235
    Matthews' coefficent Rfactor 0.194
    Waters 123 Solvent Content

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch