The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q8DWD8_STRMU protein from Streptococcus mutans. To be Published
    Site NESGC
    PDB Id 3fvw Target Id SmR99
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS27295,PF02525, PF03358, Molecular Weight 20309.79 Da.
    Residues 184 Isoelectric Point 4.70
    Sequence mskrilfivgsfsegsfnrqlakkaetiigdraqvsylsydrvpffnqdletsvhpevahareevqead aiwifspvynyaipgpvknlldwlsrsldlsdptgpsvlqdkivtvssvangaspeevfedyrsllpfi rmhlvdqltgvpinseawstgilkvsaeklaelsaqadallsaven
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2167
    Matthews' coefficent 2.98 Rfactor 0.1880
    Waters 112 Solvent Content 58.74

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch