.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g6s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the endonuclease/exonuclease/phosphatase (BVU_0621) from Bacteroides vulgatus. To be Published
    Site NESGC
    PDB Id 3g6s Target Id BvR56D
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS27213,PF03372, 3.60.10.10 Molecular Weight 29537.72 Da.
    Residues 259 Isoelectric Point 4.89
    Sequence ktdvrwatfnirydnpqdslnnwqyrkdrvcqfikdheldivgmqevlhnqfqdlraglpeydgigvgr ddgktageyaplfyrkdkyevldsntfwlaenpdsvgmmgwdavcvriatwakfkdkatgkifmavnth fdhvgeearrqsalliirkikeivgerpavvtgdfnvtdasdayetittnefvmkdayktaarvtgvdy tfhdfaripaedcekidfifvtpqvlvksceipaevpeallsdhnpqladle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.234
    Matthews' coefficent 3.09 Rfactor 0.180
    Waters 83 Solvent Content 60.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch