.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g9q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the FhuD fold-family BSU3320, a periplasmic binding protein component of a Fep/Fec-like ferrichrome ABC transporter from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR577A. To be Published
    Site NESGC
    PDB Id 3g9q Target Id SR577A
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27291,3.40.50.1980, PF01497 Molecular Weight 29935.79 Da.
    Residues 271 Isoelectric Point 8.81
    Sequence ykaengnvkipkhpkrvvvmadgyygyfktlginvvgapenvfknpyykgktngvenigdgtsvekvid lnpdliivwttqgadikklekiaptvavkydkldnieqlkefakmtgtedkaekwlakwdkkvaaaktk ikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqatkltkekaidqgpgytsisleklpdfa gdyifagpwqsggddggvfessiwknlnavknghvykmdpigfyftdpislegqlefitesltk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.291
    Matthews' coefficent 2.27 Rfactor 0.222
    Waters 31 Solvent Content 45.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g9q
    1. Specificity of Staphyloferrin B recognition by the SirA receptor from Staphylococcus aureus
    JC Grigg, J Cheung, DE Heinrichs - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch