The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of BT9727_2919 from Bacillus thuringiensis subsp. Northeast Structural Genomics Target BuR228B. To be Published
    Site NESGC
    PDB Id 3ggm Target Id BuR228B
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS28316, Molecular Weight 7734.45 Da.
    Residues 72 Isoelectric Point 6.93
    Sequence nvpdmilyngkittldpsqpevsaiaitdglitavggdellnsatektkkidlkrkraipglndshihv irg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.2630
    Matthews' coefficent 2.67 Rfactor 0.235
    Waters 169 Solvent Content 53.85

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch