.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ggn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DR_A0006 from Deinococcus radiodurans. To be Published
    Site NESGC
    PDB Id 3ggn Target Id DrR147D
    Related PDB Ids 2kcz 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS27224,3.30.530.20, PF10604, PF03364, 16100 Molecular Weight 16184.60 Da.
    Residues 146 Isoelectric Point 6.84
    Sequence getvvrdavtigkpaeqlyavwrdlpglpllmthlrsvevlddkrsrwtveapaplgtvsweaeltade pgkriawrslpgariensgevlfrpapgargtevvvrltyrppggsagaviarmfnqepsqqlrddlmr fkreqelg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.274
    Matthews' coefficent 1.93 Rfactor 0.242
    Waters 129 Solvent Content 36.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ggn
    1. Improved Technologies Now Routinely Provide Protein NMR Structures Useful for Molecular Replacement
    B Mao, R Guan, GT Montelione - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch