.
The Open Protein Structure Annotation Network
PDB Keyword
.

3goc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Endonuclease V (SAV1684) from Streptomyces avermitilis. Northeast Structural Genomics Consortium Target SvR196. To be Published
    Site NESGC
    PDB Id 3goc Target Id SvR196
    Molecular Characteristics
    Source Streptomyces avermitilis
    Alias Ids TPS27306,PF04493, BIG_203 Molecular Weight 23986.99 Da.
    Residues 229 Isoelectric Point 5.38
    Sequence mttvripagwpateeearavqdelrgrvildepgpppgtgrvtgvdvaydderdvvvaaavvldaatld vvaeatavgevsfpyvpgllafreiptvlaaldalpcppglivcdgygvahprrfglashlgvltglpt igvaknpftfsyedpgaprgsaapllagadevgralrtqsgvkpvfvsvghrvdldhacahtlaltpky ripettrradslcrralkeata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.194
    Matthews' coefficent 2.28 Rfactor 0.177
    Waters 743 Solvent Content 46.14

    Ligand Information
    Ligands YES (3-(2-HYDROXYETHYL)-2,2-BIS(HYDROXYMETHYL)PENTANE-1,5-) x 1
    Metals CL (CHLORIDE) x 1;MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch