.
The Open Protein Structure Annotation Network
PDB Keyword
.

3goz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the leucine-rich repeat-containing protein LegL7 from Legionella pneumophila. Northeast Structural Genomics Consortium target LgR148. To be Published
    Site NESGC
    PDB Id 3goz Target Id LgR148
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS27263,3.80.10.10 Molecular Weight 38324.61 Da.
    Residues 354 Isoelectric Point 5.91
    Sequence mnykltlhpgsnpveeftsiphgvtsldlslnnlysistveliqafantpasvtslnlsgnslgfknsd elvqilaaipanvtslnlsgnflsykssdelvktlaaipftitvldlgwndfssksssefkqafsnlpa sitslnlrgndlgikssdeliqilaaipanvnslnlrgnnlaskncaelakflasipasvtsldlsanl lglksyaelayifssipnhvvslnlclnclhgpslenlkllkdslkhlqtvyldydivknmskeqckal gaafpniqkiilvdkngkeihpshsipisnlirelsgkadvpsllnqclifaqkhqtniedlnipdelr esiqtckpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2620
    Matthews' coefficent 2.56 Rfactor 0.2055
    Waters 136 Solvent Content 52.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3goz
    1. Crohn's disease risk alleles on the NOD2 locus have been maintained by natural selection on standing variation
    S Nakagome, S Mano, L Kozlowski, JM Bujnicki - Molecular biology and , 2012 - SMBE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch