.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gqq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the human retinal protein 4 (unc-119 homolog A). To be Published
    Site NESGC
    PDB Id 3gqq Target Id HR3066A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27242,2.70.50.40, PF05351 Molecular Weight 21785.64 Da.
    Residues 185 Isoelectric Point 6.58
    Sequence rkqpigpedvlglqritgdylcspeeniykidfvrfkirdmdsgtvlfeikkppvserlpinrrdldpn agrfvryqftpaflrlrqvgatveftvgdkpvnnfrmierhyfrnqllksfdfhfgfcipsskntcehi ydfpplseelisemirhpyetqsdsfyfvddrlvmhnkadysysgtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.95 Rfree 0.2138
    Matthews' coefficent 2.10 Rfactor 0.1912
    Waters 803 Solvent Content 41.51

    Ligand Information
    Ligands UNL (UNKNOWN) x 30
    Metals

    Jmol

     
    Google Scholar output for 3gqq
    1. UNC119 is required for G protein trafficking in sensory neurons
    H Zhang, R Constantine, S Vorobiev, Y Chen - Nature , 2011 - nature.com
     
    2. An ARL3UNC119RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium
    KJ Wright, LM Baye, A Olivier-Mason - Genes & , 2011 - genesdev.cshlp.org
     
    3. Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119
    SA Ismail, YX Chen, M Miertzschke, IR Vetter - The EMBO , 2012 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch