.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gt0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BcR38B. To be published
    Site NESGC
    PDB Id 3gt0 Target Id BcR38B
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS27193,PF01210, 3.40.50.720, PF03807, PF03446, PF07991 Molecular Weight 26273.90 Da.
    Residues 247 Isoelectric Point 4.68
    Sequence mdkqigfigcgnmgmamiggminknivssnqiicsdlntanlknasekyglttttdnnevaknadilil sikpdlyasiineikeiikndaiivtiaagksiestenafnkkvkvvrvmpntpalvgegmsalcpnem vtekdledvlnifnsfgqteivseklmdvvtsvsgsspayvymiieamadaavldgmprnqaykfaaqa vlgsakmvletgihpgelkdmvcspggttieavatleekg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26186
    Matthews' coefficent 2.52 Rfactor 0.23069
    Waters 38 Solvent Content 51.23

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch