.
The Open Protein Structure Annotation Network
PDB Keyword
.

3guw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target GR121. To be Published
    Site NESGC
    PDB Id 3guw Target Id GR121
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS27236,PF01026, PF04909, 3.20.20.140 Molecular Weight 28288.08 Da.
    Residues 250 Isoelectric Point 4.91
    Sequence myfdshlhseglgfselvklkengikevcslaffpvkpkypqtmidvfrkltefeplrceaagvkmhpa vgihprcippdyefvlgyleegewvafgeiglelvtdeeievlksqlelakrmdvpciihtprgnklka trktleilesldfpadlavidhvnfetldmvleteywigltvqpgklsaedaarivaehgperfmlnsd agyrdveittvaeaavkieeavgreemekvarenarkflrvle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.20 Rfree 0.292
    Matthews' coefficent 2.14 Rfactor 0.241
    Waters Solvent Content 42.43

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 3guw
    1. Characterization of metalloproteins by high-throughput X-ray absorption spectroscopy
    W Shi, M Punta, J Bohon, JM Sauder, R D'Mello - Genome , 2011 - gb.cw.com.tw
     
    2. Identification of CCR2_binding features in Cytl1 by a CCL2_like chemokine model
    A Tomczak, MT Pisabarro - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch