.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gvz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Protein CV2077 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR62. To be Published
    Site NESGC
    PDB Id 3gvz Target Id CvR62
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS27221,PF03417 Molecular Weight 31018.25 Da.
    Residues 286 Isoelectric Point 8.00
    Sequence mnvmrhswlavagiagllafppvdactlwgaagtasmegsllaknrdwkpdhaqslrllhpehgyaylg lyadngsepgikagvnqkglavvaaeasslpralradsarhgvltrllrdygsldevasaadklfaqar pvfllladagglmqveigqhgryrlirqqsgtlahtnhyadtslldgaqtigpssqarlerirflldqh pahtlseferlsrdrhdgpdnslwrsgrehtlagwrialpagapprlqltlanpgraerdgdyaldsaf waqpartllp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.290
    Matthews' coefficent 3.24 Rfactor 0.259
    Waters 142 Solvent Content 61.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch