.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target DrR162B. To be published
    Site NESGC
    PDB Id 3gw4 Target Id DrR162B
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS27226,1.25.40.10 Molecular Weight 21639.89 Da.
    Residues 195 Isoelectric Point 4.88
    Sequence aafeahdyalaerqaqallahpatasgarfmlgyvyafmdrfdearasfqalqqqaqksgdhtaehral hqvgmvermagnwdaarrcfleerellaslpedplaasanayevatvalhfgdlagarqeyekslvyaq qaddqvaiacafrglgdlaqqeknlleaqqhwlrardifaeledseavnelmtrlng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.49 Rfree 0.264
    Matthews' coefficent 2.29 Rfactor 0.225
    Waters 23 Solvent Content 46.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gw4
    1. Structural, Bioinformatic, and In Vivo Analyses of Two Treponema pallidum Lipoproteins Reveal a Unique TRAP Transporter
    RK Deka, CA Brautigam, M Goldberg, P Schuck - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch