.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h9n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target IR66. To be Published
    Site NESGC
    PDB Id 3h9n Target Id IR66
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS28368,2.30.30.240, 2.40.30.60, PF01782, PF05239 Molecular Weight 20570.33 Da.
    Residues 178 Isoelectric Point 4.68
    Sequence mknmeqqhievvgklgstygirgwlriyssteqaesifdyqpwflkikgewqsielenwryhnheiivk lkgvddreaaqilanveigvdlsvfpeleegdyywhdligctvvnlegytmgtvtemmetgsndvlvvk antkdafgkqerlipflyeqvvkrvdlttktievdwdagf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.237
    Matthews' coefficent 4.40 Rfactor 0.211
    Waters 2 Solvent Content 72.04

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3h9n
    1. Target highlights in CASP9: experimental target structures for the critical assessment of techniques for protein structure prediction
    A Kryshtafovych, J Moult, SG Bartual - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch