.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h9w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target MqR66C. To be Published
    Site NESGC
    PDB Id 3h9w Target Id MqR66C
    Molecular Characteristics
    Source Marinobacter aquaeolei
    Alias Ids TPS28389,3.30.450.20, PF08447 Molecular Weight 12404.36 Da.
    Residues 106 Isoelectric Point 4.78
    Sequence tkaipwkinwqtmafeyigpqieallgwpqgswksvedwatrmhpedqewvvnfcvkqsecgvdheady ralhrdghyvwirdvvhvvrddsgevealigfmfdis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.221
    Matthews' coefficent 2.20 Rfactor 0.196
    Waters 84 Solvent Content 43.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3h9w
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch