.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ha2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target PtR24A. To be Published
    Site NESGC
    PDB Id 3ha2 Target Id PtR24A
    Molecular Characteristics
    Source Pediococcus pentosaceus
    Alias Ids TPS28421,PF02525, PF03358, 3.40.50.360 Molecular Weight 19162.02 Da.
    Residues 169 Isoelectric Point 5.29
    Sequence mqtliivahpelarsntqpffkaaienfsnvtwhplvadfnveqeqslllqndriilefplywysapal lkqwmdtvmttkfatghqyalegkelgivvstgdngnafqagaaekftiselmrpfeafanktkmmylp ilavhqflylepdaqqrllvayqqyatnvga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.22793
    Matthews' coefficent 2.58 Rfactor 0.19790
    Waters 152 Solvent Content 52.32

    Ligand Information
    Ligands SO4 (SULFATE) x 3;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ha2
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch