.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hfq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the lp_2219 protein from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 3hfq Target Id LpR118
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS28378,PF10282, 2.140.10.20, 2.120.10.20, 2.130.10.10, 2.120.10.30, 2.120.10.60 Molecular Weight 36536.69 Da.
    Residues 339 Isoelectric Point 4.89
    Sequence mqerilfgtytkktsqgiyqgtldttaktltndgllaatqnptylalsakdclysvdkeddeggiaawq idgqtahklntvvapgtppayvavdearqlvysanyhkgtaevmkiaadgaltltdtvqhsghgprpeq dgshihytdltpdnrlavidlgsdkvyvynvsdagqlseqsvltmeagfgprhlvfspdgqyaflagel ssqiaslkydaqtgaftqlgivktipadytahngaaairlshdghflyvsnrgyntlavfavtadghlt liqqistegdfprdfdldpteafvvvvnqntdnatlyardltsgklsllqkdvtvpegvcvrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.178
    Matthews' coefficent 2.16 Rfactor 0.169
    Waters 396 Solvent Content 43.18

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3hfq
    1. A new approach to assess and predict the functional roles of proteins across all known structures
    ES Julfayev, RJ McLaughlin, YP Tao - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch