.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hly

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Flavodoxin-like domain from Synechococcus sp. Q5MZP6_SYNP6 protein. To be Published
    Site NESGC
    PDB Id 3hly Target Id SnR135D
    Molecular Characteristics
    Source Synechococcus elongatus
    Alias Ids TPS28443,3.40.50.360 Molecular Weight 16235.33 Da.
    Residues 152 Isoelectric Point 4.57
    Sequence svligylsdygysdrlsqaigrglvktgvavemvdlravdpqelieavssargivlgtppsqpseavat alstifaaahnkqaiglfdsyggddepidallaqfrnlglhtafppirvkdqpteaiyqqceesgtdlg qwltradaiqtmks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2499
    Matthews' coefficent 2.09 Rfactor 0.2246
    Waters 104 Solvent Content 41.10

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3hly
    1. Structures of mannose-6-phosphate isomerase from Salmonella typhimurium bound to metal atoms and substrate: implications for catalytic mechanism
    SR Sagurthi, G Gowda, HS Savithri - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch