.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hnm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BtR319D. To be published
    Site NESGC
    PDB Id 3hnm Target Id BtR319D
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS28310,PF00754, 2.60.120.260 Molecular Weight 18740.24 Da.
    Residues 164 Isoelectric Point 4.94
    Sequence sklytvkfqpdpidkkgwsvidfnncctqdggwylnmgwgveslidnnpgtqwlcrwdvkeplpyyfvf dmgkeytlfrfgfanpvapaahvwagtskagyveasidnenwvklkdwtspkigepnvnmdvpatqary irfvitdtyptydglrvslgevyawg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.00 Rfree 0.2808
    Matthews' coefficent 3.64 Rfactor 0.2347
    Waters Solvent Content 66.22

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3hnm
    1. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch