.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hnn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target NsR435A. To be published
    Site NESGC
    PDB Id 3hnn Target Id NsR435A
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS28403,PF00753, 3.60.15.10 Molecular Weight 28669.43 Da.
    Residues 254 Isoelectric Point 6.31
    Sequence msdskprdvqvlpiatntkvlrarswsrlrfeieyalergttsnsyviegdktaiidppvesfmkiyle alqqtvnlkkldyvilghfspnriptfkallelapqitfvcslpaagdlraafpddnlnilpmrgketl dlgkghvlkflpipsprwpaglctydvqtqilytdkifgahicgddvfddnwesfkedqryyfnclmap haihveaalekisdlqvrlyavghgplvrtslialtqayadwskaqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.29197
    Matthews' coefficent 2.55 Rfactor 0.25509
    Waters 313 Solvent Content 51.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4;PEG (DI(HYDROXYETHYL)ETHER) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch