.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hno

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pyrophosphate-dependent phosphofructokinase from Nitrosospira multiformis. Northeast Structural Genomics Consortium target id NmR42. To be Published
    Site NESGC
    PDB Id 3hno Target Id NmR42
    Molecular Characteristics
    Source Nitrosospira multiformis
    Alias Ids TPS28397,3.40.50.460, PF00365, 3.40.50.450 Molecular Weight 45059.94 Da.
    Residues 419 Isoelectric Point 6.21
    Sequence maaknafyaqsggvtavinasaagvieaarkqsgkigriyagrngiigaltedlidtgqesdaaisalr ytpsgafgscryklksleqnrreyerlievfkahdigyffyngggdsadtclkvsqlsgtlgypiqaih vpktvdndlpitdccpgfgsvakyiavstleasfdvasmsatstkvfvlevmgrhagwiaaagglassp ereipvvilfpeisfdkqkflakvdscvkkfgycsvvvsegvkgddgkflsdqgvrdafghaqlggvap vvasmvkeglglkyhwgvadylqraarhiasktdveqayamgqaavefavqghnsvmptierisarpyq wkvgmaqlsqvanvekmmpenfitedgfgitdlcreylapliegedyppykdglpdyvrlknvavpkklsgftl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.241
    Matthews' coefficent 2.64 Rfactor 0.216
    Waters 441 Solvent Content 53.50

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 1

    Jmol

     
    Google Scholar output for 3hno
    1. Formation of Chiral Heteronuclear LnIII Assemblies by Ion Pair Formation
    J Gregoli_ski, R Wieczorek - European Journal of , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch