The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Virulence protein STM3117 from Salmonella typhimurium. Northeast Structural Genomics Consortium target id StR274. To be Published
    Site NESGC
    PDB Id 3hnq Target Id StR274
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS28445,PF00903, Molecular Weight 16145.65 Da.
    Residues 144 Isoelectric Point 5.12
    Sequence mlffnvaslkykhhesiqmiidridhlvltvsdisttirfyeevlgfsavtfkqnrkalifgaqkinlh qqemefepkasrptpgsadlcfitstpindvvseilqagisivegpvertgatgeimsiyirdpdgnli eisqyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.251
    Matthews' coefficent 1.95 Rfactor 0.215
    Waters 219 Solvent Content 36.86

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch