.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hnr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219. To be Published
    Site NESGC
    PDB Id 3hnr Target Id BuR219
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS28314,3.40.50.150, PF00398, PF08242, PF08241, PF05401 Molecular Weight 24263.06 Da.
    Residues 212 Isoelectric Point 4.90
    Sequence mgtefnglfdewahtydsfvqgediqykevfahyediledvvnksfgnvlefgvgtgnltnklllagrt vygiepsremrmiakeklpkefsitegdflsfevptsidtivstyafhhltddeknvaiakysqllnkg gkivfadtifadqdaydktveaakqrgfhqlandlqteyytripvmqtifenngfhvtftrlnhfvwvm eatkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.256
    Matthews' coefficent 2.13 Rfactor 0.243
    Waters 40 Solvent Content 42.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hnr
    1. Novel inhibitors of trihydroxynaphthalene reductase with antifungal activity identified by ligand-based and structure-based virtual screening
    M Brunskole vegelj, S Turk, B Brus - Journal of chemical , 2011 - ACS Publications
     
    2. The role of Ala231 and Trp227 in the substrate specificities of fungal 17 [beta]-hydroxysteroid dehydrogenase and trihydroxynaphthalene reductase: steroids versus
    MB Svegelj, J Stojan, TL Rizner - The Journal of Steroid Biochemistry and , 2011 - Elsevier
     
    3. Identification, Cloning, and Characterization of L-Phenylserine Dehydrogenase from Pseudomonas syringae NK-15
    S Ueshima, H Muramatsu, T Nakajima - Enzyme , 2010 - hindawi.com
     
    4. Insights into subtle conformational differences in the substrate-binding loop of fungal 17beta-hydroxysteroid dehydrogenase: a combined structural and kinetic
    C Alberto, K Ivet, K Katja, BS Mojca, L Doriano - Biochemical , 2012 - biochemj.org
     
    5. Naphthol radical couplings determine structural features and enantiomeric excess of dalesconols in Daldinia eschscholzii
    W Fang, S Ji, N Jiang, W Wang, GY Zhao - Nature , 2012 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch