.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target PaR365C. To be published
    Site NESGC
    PDB Id 3hvw Target Id PaR365C
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS28413,3.30.70.270 Molecular Weight 18777.42 Da.
    Residues 167 Isoelectric Point 4.92
    Sequence ideptglynrlrlqedvslrlqrdgaltviaadllplallntiirtlgypfsndlmleardriraelpd ftlykisptrfglllprqqqeetesvclrllrafespvvcrgipikanvglgvlpladdtldgdqdwlr lvvsaaddardrgvgwarynppldqaqqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.219
    Matthews' coefficent 2.54 Rfactor 0.201
    Waters 235 Solvent Content 51.49

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch