.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target MrR86. To be Published
    Site NESGC
    PDB Id 3hxj Target Id MrR86
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS28391,2.140.10.30, 2.120.10.60, 2.120.10.30, BIG_698, PF01011, 2.140.10.10, 2.130.10.10 Molecular Weight 31477.48 Da.
    Residues 282 Isoelectric Point 5.20
    Sequence mlrggvndckikweflignsidsspilakngtiylgssnknlyainpdgsvkwffksgeiieckpsigk dgtiyfgsdkvyainpdgtekwrfdtkkaivsdftifedilyvtsldghlyainpdgtekwrfktndai tsaasigkdgtiyfgsdkvyainpdgtekwnfyagywtvtrpaisedgtiyvtsldghlyainpdgtek wrfktgkriesspvigntdtiyfgsydghlyainpdgtekwnfetgswiiatpaidengtiyfgtrngk fyalfn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.26 Rfactor 0.195
    Waters 669 Solvent Content 45.51

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 3hxj
    1. SMS 2.0: An Updated Database to Study the Structural Plasticity of Short Peptide Fragments in Non-redundant Proteins
    D Ravella, MU Kumar, D Sherlin, M Shankar - Genomics, Proteomics & , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch