.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target DhR18. To be Published
    Site NESGC
    PDB Id 3hxl Target Id DhR18
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS28318,PF04984 Molecular Weight 47217.64 Da.
    Residues 438 Isoelectric Point 4.64
    Sequence maagtftaqnkvrpgvyinfksepqaagtlgergivsmplilswgepgkmitieagddvfpklgysimd aqlrlinealkraktlllyrlnagtkaavtvgnltvtakwggargnditlviqeniddetkfdvstlvd gaeldkqtvsdiaglaandwvifsgtgaltetagaplingsdgavtnqayidylaaveifdfntialps tddalkatftafakrlrddegkkiqvvlenypaadyegvisvkngvvladgtiltaaqatawvagatag arvnesltyqgydeavdvaprytnaqiiaalqageflftasdnqalveqdintltsftadkgkqfaknr virvldginndfvrifskfyigkvsnnadgrnllksecinymntlqdidaiknfdgqtdltvqsgndvd avyieayawpvdsiekiyvrvrik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.228
    Matthews' coefficent 2.76 Rfactor 0.185
    Waters 480 Solvent Content 55.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hxl
    1. A domain insertion in Escherichia coli GyrB adopts a novel fold that plays a critical role in gyrase function
    AJ Schoeffler, AP May, JM Berger - Nucleic acids research, 2010 - Oxford Univ Press
     
    2. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    3. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    4. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    5. Phage Pierces the Host Cell Membrane with the Iron-Loaded Spike
    C Browning, MM Shneider, VD Bowman, D Schwarzer - Structure, 2012 - Elsevier
     
    6. Structural Conservation of the Myoviridae Phage Tail Sheath Protein Fold
    AA Aksyuk, LP Kurochkina, A Fokine, F Forouhar - Structure, 2011 - Elsevier
     
    7. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch