.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hxp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SR577. To be Published
    Site NESGC
    PDB Id 3hxp Target Id SR577
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28433,PF01497, 3.40.50.1980 Molecular Weight 32022.83 Da.
    Residues 292 Isoelectric Point 8.61
    Sequence mgnnseskgsasdskgaetftykaengnvkipkhpkrvvvmadgyygyfktlginvvgapenvfknpyy kgktngvenigdgtsvekvidlnpdliivwttqgadikklekiaptvavkydkldnieqlkefakmtgt edkaekwlakwdkkvaaaktkikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqatkltke kaidqgpgytsisleklpdfagdyifagpwqsggddggvfessiwknlnavknghvykmdpigfyftdp islegqlefitesltk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.272
    Matthews' coefficent 2.62 Rfactor 0.222
    Waters 14 Solvent Content 53.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hxp
    1. The TB structural genomics consortium: a decade of progress
    N Chim, JE Habel, JM Johnston, I Krieger, L Miallau - Tuberculosis, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch