.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target LmR166B. To be Published
    Site NESGC
    PDB Id 3i18 Target Id LmR166B
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS28376,PF00595, 2.30.42.10 Molecular Weight 9875.58 Da.
    Residues 91 Isoelectric Point 4.99
    Sequence vkvtydgvyvlsvkddvpaadvlhagdliteidgnafkssqefidyihskkvgdtvkinykhgdkneqa dikltaidkkgtpgigitlvdd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.226
    Matthews' coefficent 1.87 Rfactor 0.193
    Waters 122 Solvent Content 34.13

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 1

    Jmol

     
    Google Scholar output for 3i18
    1. Structural model for phenylalkylamine binding to L-type calcium channels
    RCK Cheng, DB Tikhonov, BS Zhorov - Journal of Biological Chemistry, 2009 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch